(data stored in ACNUC7421 zone)

EMBL: FM180568.MODC

FM180568.MODC        Location/Qualifiers
FT   CDS             710136..711194
FT                   /transl_table=11
FT                   /gene="modC"
FT                   /locus_tag="E2348C_0642"
FT                   /product="molybdate transporter subunit"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0642"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08190"
FT                   /db_xref="GOA:B7ULN8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004606"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR011868"
FT                   /db_xref="InterPro:IPR015852"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B7ULN8"
FT                   /protein_id="CAS08190.1"
FT                   /translation="MLELNFSQTLGNHCLTINETLPANGITAIFGVSGAGKTSLINAIS
FT                   GLTRPQKGRIVLNGRVLNDADKGICLTPEKRRVGYVFQDARLFPHYKVRGNLRYGMAKS
FT                   MVNQFDKLVALLGIEPLLDRLPGSLSGGEKQRVAIGRALLTAPELLLLDEPLASLDIPR
FT                   KRELLPYLQRLTREINIPMLYVSHSLDEILHLADRVMVLENGQVKAFGALEEVWGSSVM
FT                   NPWLPKEQQSSILKVTVLEHHPHYAMTALALGDQHLWVNKLDEPLQAALRIRIQASDVS
FT                   LVLQPPQQTSIRNVLRAKVVNSYDDNGQVEVELEVGGKTLWARISPWARDELAIKPGLW
FT                   LYAQIKSVSITA"
     MLELNFSQTL GNHCLTINET LPANGITAIF GVSGAGKTSL INAISGLTRP QKGRIVLNGR        60
     VLNDADKGIC LTPEKRRVGY VFQDARLFPH YKVRGNLRYG MAKSMVNQFD KLVALLGIEP       120
     LLDRLPGSLS GGEKQRVAIG RALLTAPELL LLDEPLASLD IPRKRELLPY LQRLTREINI       180
     PMLYVSHSLD EILHLADRVM VLENGQVKAF GALEEVWGSS VMNPWLPKEQ QSSILKVTVL       240
     EHHPHYAMTA LALGDQHLWV NKLDEPLQAA LRIRIQASDV SLVLQPPQQT SIRNVLRAKV       300
     VNSYDDNGQV EVELEVGGKT LWARISPWAR DELAIKPGLW LYAQIKSVSI TA               352
//

If you have problems or comments...

PBIL Back to PBIL home page