(data stored in ACNUC7421 zone)

EMBL: FM180568.MOKC2

FM180568.MOKC2       Location/Qualifiers
FT   CDS             540153..540404
FT                   /transl_table=11
FT                   /gene="mokC2"
FT                   /locus_tag="E2348C_0482"
FT                   /product="regulatory protein MokC for HokC 2"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0482"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08030"
FT                   /db_xref="GOA:B7UKM4"
FT                   /db_xref="InterPro:IPR000021"
FT                   /db_xref="InterPro:IPR018084"
FT                   /db_xref="UniProtKB/TrEMBL:B7UKM4"
FT                   /protein_id="CAS08030.1"
FT                   /translation="MKPQEIFLSILGLPLQTQTIWMVVPSSHGGNINMLTKYALAAVIV
FT                   LCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK"
     MKPQEIFLSI LGLPLQTQTI WMVVPSSHGG NINMLTKYAL AAVIVLCLTV LGFTLLVGDS        60
     LCEFTVKERN IEFKAVLAYE PKK                                                83
//

If you have problems or comments...

PBIL Back to PBIL home page