(data stored in ACNUC7421 zone)

EMBL: FM180568.NADA

FM180568.NADA        Location/Qualifiers
FT   CDS             695669..696712
FT                   /transl_table=11
FT                   /gene="nadA"
FT                   /locus_tag="E2348C_0627"
FT                   /product="quinolinate synthase, subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0627"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08175"
FT                   /db_xref="GOA:B7ULM3"
FT                   /db_xref="InterPro:IPR003473"
FT                   /db_xref="InterPro:IPR023513"
FT                   /db_xref="InterPro:IPR036094"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7ULM3"
FT                   /protein_id="CAS08175.1"
FT                   /translation="MSVMFDPDTAIYPFPPKPTPLSIDEKAYYREKIKRLLKERNAVMV
FT                   AHYYTDPEIQQLAEETGGCISDSLEMARFGAKHPASTLLVAGVRFMGETAKILSPEKTI
FT                   LMPTLQAECSLDLGCPVEEFNAFCDAHPDRTVVVYANTSAAVKARADWVVTSSIAVELI
FT                   DHLDSLGEKIIWAPDTHLGRYVQKQTGADILCWQGACIVHDEFKTQALTRLQEEYPDAA
FT                   ILVHPESPQAIVEMADAVGSTSQLIAAAKTLQHQRLIVATDRGIFYKMQQAVPDKELLE
FT                   APTAGEGATCRSCAHCPWMAMNGLQAIAEALEQEGSNHEVYVDERLRERALVPLNRMLD
FT                   FAATLRG"
     MSVMFDPDTA IYPFPPKPTP LSIDEKAYYR EKIKRLLKER NAVMVAHYYT DPEIQQLAEE        60
     TGGCISDSLE MARFGAKHPA STLLVAGVRF MGETAKILSP EKTILMPTLQ AECSLDLGCP       120
     VEEFNAFCDA HPDRTVVVYA NTSAAVKARA DWVVTSSIAV ELIDHLDSLG EKIIWAPDTH       180
     LGRYVQKQTG ADILCWQGAC IVHDEFKTQA LTRLQEEYPD AAILVHPESP QAIVEMADAV       240
     GSTSQLIAAA KTLQHQRLIV ATDRGIFYKM QQAVPDKELL EAPTAGEGAT CRSCAHCPWM       300
     AMNGLQAIAE ALEQEGSNHE VYVDERLRER ALVPLNRMLD FAATLRG                     347
//

If you have problems or comments...

PBIL Back to PBIL home page