(data stored in ACNUC7421 zone)

EMBL: FM180568.NFRA

FM180568.NFRA        Location/Qualifiers
FT   CDS             complement(520440..523412)
FT                   /transl_table=11
FT                   /gene="nfrA"
FT                   /locus_tag="E2348C_0468"
FT                   /product="bacteriophage N4 receptor, outer membrane subunit
FT                   NfrA"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0468"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08016"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR025137"
FT                   /db_xref="UniProtKB/TrEMBL:B7UKL0"
FT                   /protein_id="CAS08016.1"
FT                   /translation="MKENNLNRVIGWSGLLLTSLLSTSALADNIGTSAEELGLSDYRHF
FT                   VIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEAYRHFGHDDRARLLL
FT                   EDQLKRHPGDDRLEHSLAAIPVEVKSVTTVEELLAQQKACDAAPTLRCRSEVGQNALRL
FT                   AQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNEARQQNTLSAAER
FT                   RQWFDVLLAAQLDDRILALQSQGIFTDPQSYITYATALAYRGEKARLQHYLIENTPLFT
FT                   TDAQEKSWLYLLSKYSGNPVQALANYTVQFADNRQYVVGATLPVLLKEGQYDAAQKLLA
FT                   TLPANEMLEERYSVSVATRNKAEALRLARLLYQQEPANLTRLDQLTWQLMQNEQSREAA
FT                   DLLLQRYPFQGDARVSQTLMARLASLLESHPYLATPAKVAILSKPLPLAEQRQWQSQLP
FT                   GIADNCPAIVRLLGDMSPSYDAAAWNRLAKCYRDTLPGVALYAWLQAEQRQPDAWQHRA
FT                   VAYQAYQVEDYATALAAWQKISLHDMSNEDLLAAANTAQAAGNGAARDRWLQQAEQRGL
FT                   GNNALYWWLHAQRYIPGQPELALNDLTRSINIAPSANAYVARATIYRQRHNVPAAVSDL
FT                   RAALELEPNNSNTQAALGYALWDSGDIAQSREMLEQAHKGLPDDPALIRQLAYVNQRLD
FT                   DMPATQHYARLVIDDIDNQALITPLTPEQNQQRFNFRRLHEEVGRRWTFSFDSSIGLRS
FT                   GAMSTANNNVGGAAPGKSYRSYRQLEAEYRIGRNMLLEGDLLSVYSRVFADTGENGVMM
FT                   PVKNPMSGTGLRWKPLRDQIFFLAVEQQLPLNGQNGASDTMLRASASFFNGGKYSDEWH
FT                   PNGSGWFAQNLYLDAAQYVRQDIQAWTADYRVSWHQKVANGQTIEPYAHVQDNGYRDKG
FT                   TQGAQLGGVGVRWNIWTGETHYDAWPHKVSLGVEYQHTFKAINQRNGERNNAFLTIGVH
FT                   W"
     MKENNLNRVI GWSGLLLTSL LSTSALADNI GTSAEELGLS DYRHFVIYPR LDKALKAQKN        60
     NDEATAIREF EYIHQQVPDN IPLTLYLAEA YRHFGHDDRA RLLLEDQLKR HPGDDRLEHS       120
     LAAIPVEVKS VTTVEELLAQ QKACDAAPTL RCRSEVGQNA LRLAQLPVAR AQLNDATFAA       180
     SPEGKTLRTD LLQRAIYLKQ WSQADTLYNE ARQQNTLSAA ERRQWFDVLL AAQLDDRILA       240
     LQSQGIFTDP QSYITYATAL AYRGEKARLQ HYLIENTPLF TTDAQEKSWL YLLSKYSGNP       300
     VQALANYTVQ FADNRQYVVG ATLPVLLKEG QYDAAQKLLA TLPANEMLEE RYSVSVATRN       360
     KAEALRLARL LYQQEPANLT RLDQLTWQLM QNEQSREAAD LLLQRYPFQG DARVSQTLMA       420
     RLASLLESHP YLATPAKVAI LSKPLPLAEQ RQWQSQLPGI ADNCPAIVRL LGDMSPSYDA       480
     AAWNRLAKCY RDTLPGVALY AWLQAEQRQP DAWQHRAVAY QAYQVEDYAT ALAAWQKISL       540
     HDMSNEDLLA AANTAQAAGN GAARDRWLQQ AEQRGLGNNA LYWWLHAQRY IPGQPELALN       600
     DLTRSINIAP SANAYVARAT IYRQRHNVPA AVSDLRAALE LEPNNSNTQA ALGYALWDSG       660
     DIAQSREMLE QAHKGLPDDP ALIRQLAYVN QRLDDMPATQ HYARLVIDDI DNQALITPLT       720
     PEQNQQRFNF RRLHEEVGRR WTFSFDSSIG LRSGAMSTAN NNVGGAAPGK SYRSYRQLEA       780
     EYRIGRNMLL EGDLLSVYSR VFADTGENGV MMPVKNPMSG TGLRWKPLRD QIFFLAVEQQ       840
     LPLNGQNGAS DTMLRASASF FNGGKYSDEW HPNGSGWFAQ NLYLDAAQYV RQDIQAWTAD       900
     YRVSWHQKVA NGQTIEPYAH VQDNGYRDKG TQGAQLGGVG VRWNIWTGET HYDAWPHKVS       960
     LGVEYQHTFK AINQRNGERN NAFLTIGVHW                                        990
//

If you have problems or comments...

PBIL Back to PBIL home page