(data stored in ACNUC7421 zone)

EMBL: FM180568.NRDR

FM180568.NRDR        Location/Qualifiers
FT   CDS             392031..392480
FT                   /transl_table=11
FT                   /gene="nrdR"
FT                   /locus_tag="E2348C_0348"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0348"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07896"
FT                   /db_xref="GOA:B7UJN6"
FT                   /db_xref="InterPro:IPR003796"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7UJN6"
FT                   /protein_id="CAS07896.1"
FT                   /translation="MHCPFCFAVDTKVIDSRLVGEGSSVRRRRQCLVCNERFTTFEVAE
FT                   LVMPRVVKSNDVREPFNEEKLRSGMLRALEKRPVSSDDVEMAINHIKSQLRATGEREVP
FT                   SKMIGNLVMEQLKKLDKVAYIRFASVYRSFEDIKEFGEEIARLED"
     MHCPFCFAVD TKVIDSRLVG EGSSVRRRRQ CLVCNERFTT FEVAELVMPR VVKSNDVREP        60
     FNEEKLRSGM LRALEKRPVS SDDVEMAINH IKSQLRATGE REVPSKMIGN LVMEQLKKLD       120
     KVAYIRFASV YRSFEDIKEF GEEIARLED                                         149
//

If you have problems or comments...

PBIL Back to PBIL home page