(data stored in ACNUC7421 zone)

EMBL: FM180568.NUSB

FM180568.NUSB        Location/Qualifiers
FT   CDS             394166..394585
FT                   /transl_table=11
FT                   /gene="nusB"
FT                   /locus_tag="E2348C_0351"
FT                   /product="transcription antitermination protein NusB"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0351"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07899"
FT                   /db_xref="GOA:B7UJN9"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR011605"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7UJN9"
FT                   /protein_id="CAS07899.1"
FT                   /translation="MKPAARRRARECAVQALYSWQLSQNDIADVEYQFLAEQDVKDVDV
FT                   LYFRELLAGVATNTAYLDGLMKPYLSRLLEELGQVEKAVLRIALYELSKRSDVPYKVAI
FT                   NEAIELAKSFGAEDSHKFVNGVLDKAAPVIRPNKK"
     MKPAARRRAR ECAVQALYSW QLSQNDIADV EYQFLAEQDV KDVDVLYFRE LLAGVATNTA        60
     YLDGLMKPYL SRLLEELGQV EKAVLRIALY ELSKRSDVPY KVAINEAIEL AKSFGAEDSH       120
     KFVNGVLDKA APVIRPNKK                                                    139
//

If you have problems or comments...

PBIL Back to PBIL home page