(data stored in ACNUC7421 zone)

EMBL: FM180568.PE153

FM180568.PE153       Location/Qualifiers
FT   CDS             173313..173879
FT                   /transl_table=11
FT                   /locus_tag="E2348C_0153"
FT                   /product="predicted fimbrial protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0153"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07701"
FT                   /db_xref="GOA:B7UIJ4"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:B7UIJ4"
FT                   /protein_id="CAS07701.1"
FT                   /translation="MNKKLLSLLVSGSFIAAVSTSVFAADTGVVNFNGKIVADTCEINV
FT                   NDSNSTTGIVTFADTYPADYSGDGTVGTSKDFKIELIKCDPLVTKLNLTFSGTTTDTGF
FT                   LRLENSETATGSATNVGITVTNKNGGTNNVKFDGSVPDVSTDVDNAGDSTPTIFNYTAN
FT                   VIQVGNNAPTAGKYASSATFEVFYR"
     MNKKLLSLLV SGSFIAAVST SVFAADTGVV NFNGKIVADT CEINVNDSNS TTGIVTFADT        60
     YPADYSGDGT VGTSKDFKIE LIKCDPLVTK LNLTFSGTTT DTGFLRLENS ETATGSATNV       120
     GITVTNKNGG TNNVKFDGSV PDVSTDVDNA GDSTPTIFNY TANVIQVGNN APTAGKYASS       180
     ATFEVFYR                                                                188
//

If you have problems or comments...

PBIL Back to PBIL home page