(data stored in ACNUC7421 zone)

EMBL: FM180568.PE155

FM180568.PE155       Location/Qualifiers
FT   CDS             174685..177162
FT                   /transl_table=11
FT                   /locus_tag="E2348C_0155"
FT                   /product="predicted fimbrial outer membrane usher protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0155"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07703"
FT                   /db_xref="GOA:B7UIJ5"
FT                   /db_xref="InterPro:IPR000015"
FT                   /db_xref="InterPro:IPR025885"
FT                   /db_xref="InterPro:IPR025949"
FT                   /db_xref="InterPro:IPR037224"
FT                   /db_xref="InterPro:IPR042186"
FT                   /db_xref="UniProtKB/TrEMBL:B7UIJ5"
FT                   /protein_id="CAS07703.1"
FT                   /translation="MSLPMHRTFVLTGIIFALSAVYSLSYARDEFNLRILELDSPLENT
FT                   QVLADFINNNNLTPGVYLTSVMWGQDSLDKRNITFVLSSDKKSLIPRFTKADLREFGLK
FT                   VDVIPALKVMNDDTEVGDIAQIIDGARYDFQLDSQTLWLRIPQIYQNAIAAGSIAPKYW
FT                   NDGESAAWLSYYASGSRQNSDGDNLSSNWLNLNSGINLGAWRLRNNTVYNESNWESIST
FT                   SLQRDIKALRSQMEIGQTFTNGDLFDSVQMTGIKLETDTSMLPDSEQGFAPVVRVIANS
FT                   DAQVVIKQNGYVIYQTWVSAGPFEIKDLSQVTAGSDLEVTIKETNGQEHSFIQASSTVP
FT                   ILQREGALKYSLAAGKYRDSDNNAETPVFGVATAIYGLPYGITIYGGILGASMYHSGVT
FT                   GIGADLGRLGSVSVDITAAKTKFDDGRDDATGLSWRAQYAKDFPDTDTTVTLASYRYST
FT                   SQFYTFQEALDQRDTPDDKGIYSYRQTNNRRNRLQINLSQNIGRWGSVYLNGYQQDYWG
FT                   MHGAERSIGMGYSTTWNNINWSVNYTLTKTPGMTGEQQFSLTLNIPLSRWLPDSWAMYN
FT                   VNRSDKSNTSHQLGIGGTALQDNNLSYNLQQSYTDNNVGYGASMNGRYRSSVGEFGLGY
FT                   SYDKNSRQWNYSAQGAVVAHAHGVTLGQSVQDSFAIVHINEGANVKVQNAQGVYTDFWG
FT                   NAIVPNMTNYRHNAITVNTQGHDSLDISDATQDVIPSKGAVVGVDFDARSGMRALLTLV
FT                   HNKERVPFGALLTLGNSTAIVGEDGEVYITGVQESMTFTVQWGKEINQQCTGVITEPEK
FT                   YTTGIYKATMDCR"
     MSLPMHRTFV LTGIIFALSA VYSLSYARDE FNLRILELDS PLENTQVLAD FINNNNLTPG        60
     VYLTSVMWGQ DSLDKRNITF VLSSDKKSLI PRFTKADLRE FGLKVDVIPA LKVMNDDTEV       120
     GDIAQIIDGA RYDFQLDSQT LWLRIPQIYQ NAIAAGSIAP KYWNDGESAA WLSYYASGSR       180
     QNSDGDNLSS NWLNLNSGIN LGAWRLRNNT VYNESNWESI STSLQRDIKA LRSQMEIGQT       240
     FTNGDLFDSV QMTGIKLETD TSMLPDSEQG FAPVVRVIAN SDAQVVIKQN GYVIYQTWVS       300
     AGPFEIKDLS QVTAGSDLEV TIKETNGQEH SFIQASSTVP ILQREGALKY SLAAGKYRDS       360
     DNNAETPVFG VATAIYGLPY GITIYGGILG ASMYHSGVTG IGADLGRLGS VSVDITAAKT       420
     KFDDGRDDAT GLSWRAQYAK DFPDTDTTVT LASYRYSTSQ FYTFQEALDQ RDTPDDKGIY       480
     SYRQTNNRRN RLQINLSQNI GRWGSVYLNG YQQDYWGMHG AERSIGMGYS TTWNNINWSV       540
     NYTLTKTPGM TGEQQFSLTL NIPLSRWLPD SWAMYNVNRS DKSNTSHQLG IGGTALQDNN       600
     LSYNLQQSYT DNNVGYGASM NGRYRSSVGE FGLGYSYDKN SRQWNYSAQG AVVAHAHGVT       660
     LGQSVQDSFA IVHINEGANV KVQNAQGVYT DFWGNAIVPN MTNYRHNAIT VNTQGHDSLD       720
     ISDATQDVIP SKGAVVGVDF DARSGMRALL TLVHNKERVP FGALLTLGNS TAIVGEDGEV       780
     YITGVQESMT FTVQWGKEIN QQCTGVITEP EKYTTGIYKA TMDCR                       825
//

If you have problems or comments...

PBIL Back to PBIL home page