(data stored in ACNUC7421 zone)

EMBL: FM180568.PE156

FM180568.PE156       Location/Qualifiers
FT   CDS             177184..178194
FT                   /transl_table=11
FT                   /locus_tag="E2348C_0156"
FT                   /product="predicted fimbrial protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0156"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07704"
FT                   /db_xref="GOA:B7UIJ6"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:B7UIJ6"
FT                   /protein_id="CAS07704.1"
FT                   /translation="MKPGFASYIRALLTIIFLSWGVIPAVFASCNISGNGGNPATVQFS
FT                   APALVVNSDAVPGTIIATVNANSPSISVSCTANGEIWQGYTVLTNGDKRTDNPLTDVFQ
FT                   TNVPGIGFRAAWANNTSAQLTAGSLMTPWHKGSSTVIKGYVYPITIHAAIQFIVTGPVG
FT                   NGTIDTSKLIADWKYDNRVIGELRFSSVPVNIQPGTCDLIEKNITVPLNDIGTDDFDVN
FT                   NVSPVVSDDRFKIQIEKCSQDVKVDYRFTSSGSTGITGNSILNIESGSGMAEGVGLQIL
FT                   DSSNNVMVFDSDYTAIQKTTLNQNITIPLKARYIKTGSVKSGRVNSVATFEVYYR"
     MKPGFASYIR ALLTIIFLSW GVIPAVFASC NISGNGGNPA TVQFSAPALV VNSDAVPGTI        60
     IATVNANSPS ISVSCTANGE IWQGYTVLTN GDKRTDNPLT DVFQTNVPGI GFRAAWANNT       120
     SAQLTAGSLM TPWHKGSSTV IKGYVYPITI HAAIQFIVTG PVGNGTIDTS KLIADWKYDN       180
     RVIGELRFSS VPVNIQPGTC DLIEKNITVP LNDIGTDDFD VNNVSPVVSD DRFKIQIEKC       240
     SQDVKVDYRF TSSGSTGITG NSILNIESGS GMAEGVGLQI LDSSNNVMVF DSDYTAIQKT       300
     TLNQNITIPL KARYIKTGSV KSGRVNSVAT FEVYYR                                 336
//

If you have problems or comments...

PBIL Back to PBIL home page