(data stored in ACNUC7421 zone)

EMBL: FM180568.PE18

FM180568.PE18        Location/Qualifiers
FT   CDS             17619..18380
FT                   /transl_table=11
FT                   /locus_tag="E2348C_0018"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0018"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07566"
FT                   /db_xref="GOA:B7UI63"
FT                   /db_xref="InterPro:IPR018013"
FT                   /db_xref="InterPro:IPR036777"
FT                   /db_xref="UniProtKB/TrEMBL:B7UI63"
FT                   /protein_id="CAS07566.1"
FT                   /translation="MSAKRRLLIACTLITAIYHFPAYSSLEYKGTFGSINAGYADWNSG
FT                   FVNTHRGEVWKVTADFGVNFKEAEFYSFYESNVLNHAVAGRNHTVSAMTHVRLFDSDMT
FT                   FFGKIYGQWDNSWGDDLDMFYGFGYLGWNGEWGFFKPYIGLHNQSGDYVSAKYGQTNGW
FT                   NGYVVGWTAVLPFTLFDEKFVLSNWNEIELDRNDAYTEQQFGRNGLNGGLTIAWKFYPR
FT                   WKASVTWRYFDNKLGYDGFGDQMIYMLGYDF"
     MSAKRRLLIA CTLITAIYHF PAYSSLEYKG TFGSINAGYA DWNSGFVNTH RGEVWKVTAD        60
     FGVNFKEAEF YSFYESNVLN HAVAGRNHTV SAMTHVRLFD SDMTFFGKIY GQWDNSWGDD       120
     LDMFYGFGYL GWNGEWGFFK PYIGLHNQSG DYVSAKYGQT NGWNGYVVGW TAVLPFTLFD       180
     EKFVLSNWNE IELDRNDAYT EQQFGRNGLN GGLTIAWKFY PRWKASVTWR YFDNKLGYDG       240
     FGDQMIYMLG YDF                                                          253
//

If you have problems or comments...

PBIL Back to PBIL home page