(data stored in ACNUC7421 zone)

EMBL: FM180568.PE20

FM180568.PE20        Location/Qualifiers
FT   CDS             20023..21282
FT                   /transl_table=11
FT                   /locus_tag="E2348C_0020"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0020"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07568"
FT                   /db_xref="UniProtKB/TrEMBL:B7UI65"
FT                   /protein_id="CAS07568.1"
FT                   /translation="MFTNVNVDCCKTPGCKNLGLLNSQDYVAQGKNILCRECGYLFPVI
FT                   SEQSLNIYRNIVNHSWRGLICQCSTCGGTSLKKYGYSAQGQRRMYCHHCEKTFITLEHV
FT                   ITTPRGAQLALMIEQGEALADIRKSLLLNSTGLSRELLKLAREANYKESRQCFPASDIT
FT                   LSTRAFRVKYNGSNNSLYALVTAEEQSGRVVAISTNYSSSAVEQHYQYTSNYEERMSPG
FT                   TLAHHVQRKELLTMRRDTLFDIDYGPAVLHQNDPGMLVKPVLPAYRHFELVRILTDEHS
FT                   NNVQHYLDHECFILGGCLMANLQHIHQGRCHISFVKERGVAPATIDFPPRLFLSGGVRN
FT                   NVWRAFSNRNYSMAVCNLTGSKKVREMRHATLNSATRFIHFVENHPFLISLNRMSPANV
FT                   VSTLDILKHLWNKKLEHGTI"
     MFTNVNVDCC KTPGCKNLGL LNSQDYVAQG KNILCRECGY LFPVISEQSL NIYRNIVNHS        60
     WRGLICQCST CGGTSLKKYG YSAQGQRRMY CHHCEKTFIT LEHVITTPRG AQLALMIEQG       120
     EALADIRKSL LLNSTGLSRE LLKLAREANY KESRQCFPAS DITLSTRAFR VKYNGSNNSL       180
     YALVTAEEQS GRVVAISTNY SSSAVEQHYQ YTSNYEERMS PGTLAHHVQR KELLTMRRDT       240
     LFDIDYGPAV LHQNDPGMLV KPVLPAYRHF ELVRILTDEH SNNVQHYLDH ECFILGGCLM       300
     ANLQHIHQGR CHISFVKERG VAPATIDFPP RLFLSGGVRN NVWRAFSNRN YSMAVCNLTG       360
     SKKVREMRHA TLNSATRFIH FVENHPFLIS LNRMSPANVV STLDILKHLW NKKLEHGTI        419
//

If you have problems or comments...

PBIL Back to PBIL home page