(data stored in ACNUC7421 zone)

EMBL: FM180568.PE223

FM180568.PE223       Location/Qualifiers
FT   CDS             complement(254790..255146)
FT                   /transl_table=11
FT                   /locus_tag="E2348C_0223"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0223"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07771"
FT                   /db_xref="GOA:B7UJB9"
FT                   /db_xref="InterPro:IPR008651"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR035069"
FT                   /db_xref="UniProtKB/TrEMBL:B7UJB9"
FT                   /protein_id="CAS07771.1"
FT                   /translation="MNKASNIITIKGQPAAVTFEADINAFRGKFLNVNGYCDFVATSIE
FT                   ALYREGESALDEWMADCEEDGIAPFREEEEQKRLTLRVPHHIDSRLTIVARQHSISKNQ
FT                   LIIDVLEREFSAQM"
     MNKASNIITI KGQPAAVTFE ADINAFRGKF LNVNGYCDFV ATSIEALYRE GESALDEWMA        60
     DCEEDGIAPF REEEEQKRLT LRVPHHIDSR LTIVARQHSI SKNQLIIDVL EREFSAQM         118
//

If you have problems or comments...

PBIL Back to PBIL home page