(data stored in ACNUC7421 zone)

EMBL: FM180568.PE228

FM180568.PE228       Location/Qualifiers
FT   CDS             259757..260896
FT                   /transl_table=11
FT                   /locus_tag="E2348C_0228"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0228"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07776"
FT                   /db_xref="GOA:B7UJC3"
FT                   /db_xref="InterPro:IPR001233"
FT                   /db_xref="InterPro:IPR017510"
FT                   /db_xref="InterPro:IPR036025"
FT                   /db_xref="UniProtKB/TrEMBL:B7UJC3"
FT                   /protein_id="CAS07776.1"
FT                   /translation="MGKYIRPLSDAVLTIASDDLWIESSAIQQLHTTANLPDMQRVVGM
FT                   PDLHPGRGYPIGAAFFSVGRFYPALVGNDIGCGMALWQTDIFARKYNADKFEKRLSDLD
FT                   DVAEESWLEENLPSAFAQHPWRSSLGSIGGGNHFAELQQIDQIIDAELFALAGLDAQHL
FT                   QLLVHSGSRGLGQSILQRHIASFSHHGLPEGSDDALSYIAEHDDALAFARINRQLIALR
FT                   IMQQVKANGNSVLDVAHNFVSACRIGDQQGWLHRKGATPDDNGLVIIPGSRGDYSWLVK
FT                   PVANEKTLHSLAHGAGRKWGRTECKGRLAAKYTATQLSRTELGSRVICRDKQLIFEEAP
FT                   QAYKSAESVVQCLVLAGLIIPVARLRPVLTLKNSGGKKG"
     MGKYIRPLSD AVLTIASDDL WIESSAIQQL HTTANLPDMQ RVVGMPDLHP GRGYPIGAAF        60
     FSVGRFYPAL VGNDIGCGMA LWQTDIFARK YNADKFEKRL SDLDDVAEES WLEENLPSAF       120
     AQHPWRSSLG SIGGGNHFAE LQQIDQIIDA ELFALAGLDA QHLQLLVHSG SRGLGQSILQ       180
     RHIASFSHHG LPEGSDDALS YIAEHDDALA FARINRQLIA LRIMQQVKAN GNSVLDVAHN       240
     FVSACRIGDQ QGWLHRKGAT PDDNGLVIIP GSRGDYSWLV KPVANEKTLH SLAHGAGRKW       300
     GRTECKGRLA AKYTATQLSR TELGSRVICR DKQLIFEEAP QAYKSAESVV QCLVLAGLII       360
     PVARLRPVLT LKNSGGKKG                                                    379
//

If you have problems or comments...

PBIL Back to PBIL home page