(data stored in ACNUC7421 zone)

EMBL: FM180568.PE251

FM180568.PE251       Location/Qualifiers
FT   CDS             282198..282488
FT                   /transl_table=11
FT                   /locus_tag="E2348C_0251"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0251"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07799"
FT                   /db_xref="UniProtKB/TrEMBL:B7UJE3"
FT                   /protein_id="CAS07799.1"
FT                   /translation="MICQSVRCFNGLTCRTKWLWVFIPISDEKLNRCKYVICPVSPLRA
FT                   KLSEVKRRLPVVTGTMASLPGHCIQSSVRVTLTGTRTSAMGLPMDLAVPVA"
     MICQSVRCFN GLTCRTKWLW VFIPISDEKL NRCKYVICPV SPLRAKLSEV KRRLPVVTGT        60
     MASLPGHCIQ SSVRVTLTGT RTSAMGLPMD LAVPVA                                  96
//

If you have problems or comments...

PBIL Back to PBIL home page