(data stored in ACNUC7421 zone)

EMBL: FM180568.PE271

FM180568.PE271       Location/Qualifiers
FT   CDS             complement(304219..304431)
FT                   /transl_table=11
FT                   /locus_tag="E2348C_0271"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0271"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07819"
FT                   /db_xref="UniProtKB/TrEMBL:B7UJG2"
FT                   /protein_id="CAS07819.1"
FT                   /translation="MDSCLFHCKYPGIINVRIFTEEQHNHDGTGLSQVVLNAIHNLVYR
FT                   LQVYVQTTYLSQQSSIIRYTAFTGP"
     MDSCLFHCKY PGIINVRIFT EEQHNHDGTG LSQVVLNAIH NLVYRLQVYV QTTYLSQQSS        60
     IIRYTAFTGP                                                               70
//

If you have problems or comments...

PBIL Back to PBIL home page