(data stored in ACNUC7421 zone)

EMBL: FM180568.PE34

FM180568.PE34        Location/Qualifiers
FT   CDS             complement(36958..37176)
FT                   /transl_table=11
FT                   /locus_tag="E2348C_0034"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0034"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07582"
FT                   /db_xref="UniProtKB/TrEMBL:B7UI79"
FT                   /protein_id="CAS07582.1"
FT                   /translation="MTRFAAIKQGHIKIVDISIVCNFTVDKCELNPAYVIKNIDSPKDL
FT                   LNGQKKRSSSENRISYSIKLADEKYPP"
     MTRFAAIKQG HIKIVDISIV CNFTVDKCEL NPAYVIKNID SPKDLLNGQK KRSSSENRIS        60
     YSIKLADEKY PP                                                            72
//

If you have problems or comments...

PBIL Back to PBIL home page