(data stored in ACNUC7421 zone)

EMBL: FM180568.PE424

FM180568.PE424       Location/Qualifiers
FT   CDS             complement(475527..475949)
FT                   /transl_table=11
FT                   /locus_tag="E2348C_0424"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0424"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07972"
FT                   /db_xref="UniProtKB/TrEMBL:B7UKG8"
FT                   /protein_id="CAS07972.1"
FT                   /translation="MMNSSIKSFSLLAVILLAGCSSPTSRIADCQAQGVSHDTCYLAEQ
FT                   QRQTAILSASEAQAFKNAEAAQHAQAAKKAIYKGFGMTFRMSSKNFAYLNDSLCVIDED
FT                   NKDATVYQSGLYNVIVYHHTGKVALMKEGQFVGYLK"
     MMNSSIKSFS LLAVILLAGC SSPTSRIADC QAQGVSHDTC YLAEQQRQTA ILSASEAQAF        60
     KNAEAAQHAQ AAKKAIYKGF GMTFRMSSKN FAYLNDSLCV IDEDNKDATV YQSGLYNVIV       120
     YHHTGKVALM KEGQFVGYLK                                                   140
//

If you have problems or comments...

PBIL Back to PBIL home page