(data stored in ACNUC7421 zone)

EMBL: FM180568.PE425

FM180568.PE425       Location/Qualifiers
FT   CDS             complement(476003..477019)
FT                   /transl_table=11
FT                   /locus_tag="E2348C_0425"
FT                   /product="predicted autotransporter adhesin, STEC
FT                   autoagglutinating adhesin (Saa)-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0425"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07973"
FT                   /db_xref="InterPro:IPR005594"
FT                   /db_xref="UniProtKB/TrEMBL:B7UKG9"
FT                   /protein_id="CAS07973.1"
FT                   /translation="MKTVNVALLALIISATSSPFVLAGDTIEAAATELSAINSGMSQSE
FT                   IEQKITRFLERTDNSPAAYTYLTEHHYIPSETPDTTQTPPVQTDPDAGQKTVAATGDVQ
FT                   TTARYQSMINARQSTVTDAQQTQITEQQAQIVATQKTLAATGDTQNTAHYQEMINARLA
FT                   AQNEANQRTTTEQGQKMNALTTDVAAQQQKERAQYDKQMQSLAQKSVQAHEQIESLRQD
FT                   SAQTQQQLTNTQKRVADNSQQINTLNNHFSSLKNEVEDNRKEANAGTASAIAIASQPQV
FT                   KTGDLMMVSAGAGTFNGESAVSVGTSFNAGTHTVLKAGISADTQSDFGAGVGVGYSF"
     MKTVNVALLA LIISATSSPF VLAGDTIEAA ATELSAINSG MSQSEIEQKI TRFLERTDNS        60
     PAAYTYLTEH HYIPSETPDT TQTPPVQTDP DAGQKTVAAT GDVQTTARYQ SMINARQSTV       120
     TDAQQTQITE QQAQIVATQK TLAATGDTQN TAHYQEMINA RLAAQNEANQ RTTTEQGQKM       180
     NALTTDVAAQ QQKERAQYDK QMQSLAQKSV QAHEQIESLR QDSAQTQQQL TNTQKRVADN       240
     SQQINTLNNH FSSLKNEVED NRKEANAGTA SAIAIASQPQ VKTGDLMMVS AGAGTFNGES       300
     AVSVGTSFNA GTHTVLKAGI SADTQSDFGA GVGVGYSF                               338
//

If you have problems or comments...

PBIL Back to PBIL home page