(data stored in ACNUC7421 zone)

EMBL: FM180568.PE426

FM180568.PE426       Location/Qualifiers
FT   CDS             477387..477749
FT                   /transl_table=11
FT                   /locus_tag="E2348C_0426"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0426"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07974"
FT                   /db_xref="UniProtKB/TrEMBL:B7UKH0"
FT                   /protein_id="CAS07974.1"
FT                   /translation="MNEFEKIFNEMNLDRALLPILFRSNRSTVWKYLSGDSTAPASAMS
FT                   LIMLLQLIQKRNPDLLAEWLTLSDFTIPPEVYLDQPDYWKGWVYTQHKVNKNVLEYLKK
FT                   HYPDEDQKSMGKGREE"
     MNEFEKIFNE MNLDRALLPI LFRSNRSTVW KYLSGDSTAP ASAMSLIMLL QLIQKRNPDL        60
     LAEWLTLSDF TIPPEVYLDQ PDYWKGWVYT QHKVNKNVLE YLKKHYPDED QKSMGKGREE       120
//

If you have problems or comments...

PBIL Back to PBIL home page