(data stored in ACNUC7421 zone)

EMBL: FM180568.PE51

FM180568.PE51        Location/Qualifiers
FT   CDS             53500..53814
FT                   /transl_table=11
FT                   /locus_tag="E2348C_0051"
FT                   /product="CcdB-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0051"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07599"
FT                   /db_xref="GOA:B7UI96"
FT                   /db_xref="InterPro:IPR002712"
FT                   /db_xref="InterPro:IPR011067"
FT                   /db_xref="UniProtKB/TrEMBL:B7UI96"
FT                   /protein_id="CAS07599.1"
FT                   /translation="MQFTVYRSRGRNAAFPFVIDVTSDIIGEINRRIVIPLTPIERFSR
FT                   IRPPERLNPILLLVDGKEYVLMTHETATVPVNALGTKFCDASAHRTLIKGALDFMLDGI
FT                   "
     MQFTVYRSRG RNAAFPFVID VTSDIIGEIN RRIVIPLTPI ERFSRIRPPE RLNPILLLVD        60
     GKEYVLMTHE TATVPVNALG TKFCDASAHR TLIKGALDFM LDGI                        104
//

If you have problems or comments...

PBIL Back to PBIL home page