(data stored in ACNUC7421 zone)

EMBL: FM180568.PE549

FM180568.PE549       Location/Qualifiers
FT   CDS             609056..610933
FT                   /transl_table=11
FT                   /locus_tag="E2348C_0549"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0549"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08097"
FT                   /db_xref="GOA:B7UKT9"
FT                   /db_xref="InterPro:IPR011045"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:B7UKT9"
FT                   /protein_id="CAS08097.1"
FT                   /translation="MSASSVKPLNVQLPAITLILFALCVGIFCYLAQWMSYEEVDQSAL
FT                   IHLGANVASLTLSGEPWRLLSSVFLHSSFSHLLMNMFALLAVGTVAERILGKWRLLIIW
FT                   LFSGIFGGLISACYALRESEQIVISVGASGAIMGIAGAAIATQLASGAGTHHKNQRRVF
FT                   PLLGMVALTLLYGTRQTGIDNACHIGGLIAGGALGWLSARLVGQNRLVTEGGIIVAVTL
FT                   LLTGTIWLVQQQIDESVLQVRQSLREAFYPQEIEQERRQKKQQLVEERNALRETLSAPV
FT                   SREQASGDLLAEIADIHDMAISRDANTLYAAIENTNSIVVFDLGQKKILHTFTAPIAKE
FT                   KSVKHCGGCKDQGVRSMALSLDEKLIYATSFEANALSVINVATGEIIQSITTGAHPDSL
FT                   ILSCDGTKAWVMNRTSNSVSAIDLVAYQHVADIPLEKYDGTGMSGKPGAWVMALSPDEK
FT                   TLLVPGAGRGNIVRFNTITHQKEDFPAGNARGVVSAMGFRPKNGEVIFADSQGISRIRA
FT                   EDQQASIMTQWCRRSVYSVEGISPDGQYLALVSYGLQGYVILLNINAGQIIGVYPASYV
FT                   NNLRFSADGRKIFVMAKNRLIQMDRTRSIDPQAIIRHPQYGDVACIPET"
     MSASSVKPLN VQLPAITLIL FALCVGIFCY LAQWMSYEEV DQSALIHLGA NVASLTLSGE        60
     PWRLLSSVFL HSSFSHLLMN MFALLAVGTV AERILGKWRL LIIWLFSGIF GGLISACYAL       120
     RESEQIVISV GASGAIMGIA GAAIATQLAS GAGTHHKNQR RVFPLLGMVA LTLLYGTRQT       180
     GIDNACHIGG LIAGGALGWL SARLVGQNRL VTEGGIIVAV TLLLTGTIWL VQQQIDESVL       240
     QVRQSLREAF YPQEIEQERR QKKQQLVEER NALRETLSAP VSREQASGDL LAEIADIHDM       300
     AISRDANTLY AAIENTNSIV VFDLGQKKIL HTFTAPIAKE KSVKHCGGCK DQGVRSMALS       360
     LDEKLIYATS FEANALSVIN VATGEIIQSI TTGAHPDSLI LSCDGTKAWV MNRTSNSVSA       420
     IDLVAYQHVA DIPLEKYDGT GMSGKPGAWV MALSPDEKTL LVPGAGRGNI VRFNTITHQK       480
     EDFPAGNARG VVSAMGFRPK NGEVIFADSQ GISRIRAEDQ QASIMTQWCR RSVYSVEGIS       540
     PDGQYLALVS YGLQGYVILL NINAGQIIGV YPASYVNNLR FSADGRKIFV MAKNRLIQMD       600
     RTRSIDPQAI IRHPQYGDVA CIPET                                             625
//

If you have problems or comments...

PBIL Back to PBIL home page