(data stored in ACNUC7421 zone)

EMBL: FM180568.PE562

FM180568.PE562       Location/Qualifiers
FT   CDS             complement(627456..628736)
FT                   /transl_table=11
FT                   /locus_tag="E2348C_0562"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0562"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08110"
FT                   /db_xref="GOA:B7UKV2"
FT                   /db_xref="InterPro:IPR001898"
FT                   /db_xref="UniProtKB/TrEMBL:B7UKV2"
FT                   /protein_id="CAS08110.1"
FT                   /translation="MTMEMILALGILVLMIVLIMSDKMPFGAPPLLACLLLVVSGLSTV
FT                   QQAFAGFVNPSVVMIAGFMVVMAALQKTRLISNVKSAMISLVNKGSYRSYGLLLVIVML
FT                   GASLAGTGATGYYVLILSLVSTIPYSKKLPTSKLMMPLGFATNHPLLPINLALLFGVTA
FT                   TVLETAGFHQEISMGRFALVNLIMSAAFLAWSLIAYRFLPDHPIADASEDALAAREETF
FT                   NALPAWKEYCTIAAFAVSVIGMMLMNILGNIAFVIPGLAGAFVLMIDVLDFKEVRDHMG
FT                   APVILMMAGVIGVADALAGTGFTAMVGDAVAGVLGSGVSPFVFIVAFALLTSTCATFTG
FT                   SNMGSVYIFAPIAIAACTSLGLNPTAAAIAVVISGWNGGYMPIDGMPAMILGMGKYKLP
FT                   EFWVFSVPMYLIRILALCAGAVFIFPM"
     MTMEMILALG ILVLMIVLIM SDKMPFGAPP LLACLLLVVS GLSTVQQAFA GFVNPSVVMI        60
     AGFMVVMAAL QKTRLISNVK SAMISLVNKG SYRSYGLLLV IVMLGASLAG TGATGYYVLI       120
     LSLVSTIPYS KKLPTSKLMM PLGFATNHPL LPINLALLFG VTATVLETAG FHQEISMGRF       180
     ALVNLIMSAA FLAWSLIAYR FLPDHPIADA SEDALAAREE TFNALPAWKE YCTIAAFAVS       240
     VIGMMLMNIL GNIAFVIPGL AGAFVLMIDV LDFKEVRDHM GAPVILMMAG VIGVADALAG       300
     TGFTAMVGDA VAGVLGSGVS PFVFIVAFAL LTSTCATFTG SNMGSVYIFA PIAIAACTSL       360
     GLNPTAAAIA VVISGWNGGY MPIDGMPAMI LGMGKYKLPE FWVFSVPMYL IRILALCAGA       420
     VFIFPM                                                                  426
//

If you have problems or comments...

PBIL Back to PBIL home page