(data stored in ACNUC7421 zone)

EMBL: FM180568.PE563

FM180568.PE563       Location/Qualifiers
FT   CDS             complement(628750..629220)
FT                   /transl_table=11
FT                   /locus_tag="E2348C_0563"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0563"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08111"
FT                   /db_xref="InterPro:IPR004375"
FT                   /db_xref="InterPro:IPR037012"
FT                   /db_xref="UniProtKB/TrEMBL:B7UKV3"
FT                   /protein_id="CAS08111.1"
FT                   /translation="MIIGNLNHLSLAGLPAWVRNILLCPECSLSALSAREDGRWQPEGC
FT                   RWFCTLGTSDTQPAELRHTEYHHLWADIQVVITGCEGINAGTRPIARENDEERKPDLFI
FT                   APSPENSVAITLHPGDFAVFMPEEPHQALCAIGAATSVRKAVFKVPRDMLEA"
     MIIGNLNHLS LAGLPAWVRN ILLCPECSLS ALSAREDGRW QPEGCRWFCT LGTSDTQPAE        60
     LRHTEYHHLW ADIQVVITGC EGINAGTRPI ARENDEERKP DLFIAPSPEN SVAITLHPGD       120
     FAVFMPEEPH QALCAIGAAT SVRKAVFKVP RDMLEA                                 156
//

If you have problems or comments...

PBIL Back to PBIL home page