(data stored in ACNUC7421 zone)

EMBL: FM180568.PE564

FM180568.PE564       Location/Qualifiers
FT   CDS             complement(629217..630386)
FT                   /transl_table=11
FT                   /locus_tag="E2348C_0564"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0564"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08112"
FT                   /db_xref="InterPro:IPR011040"
FT                   /db_xref="InterPro:IPR036278"
FT                   /db_xref="UniProtKB/TrEMBL:B7UKV4"
FT                   /protein_id="CAS08112.1"
FT                   /translation="MSVALIRDGVIRPSENDSHVLTAMLPSSCPQNHAANILPMPDGAL
FT                   MCVWFAGTQEGIADISVWGSRLPAGRTQWSDAVKLSHDDTRSEQNPVLFLAPDNVLWLL
FT                   WTAQISGNQDTAIVRYRKSDDLGQTWGEIATLLDKPGTFIRQPITVLDNGNWLLPVFYC
FT                   RTQPGEKWVGNDDISAVKISADGGHSWRDVEVPQSLGCVHMNITMLHDGTLVALFRSRW
FT                   ADNIYISHSVDNGESWSVPQATELPNNNSSIQVTTLASGELALVYNAMSAAGAVERRAS
FT                   LYDEIDDGDDSRKEPTAVGRSAFWGAPRAPMTVAISADGGKSWPWRRNLDEGDGNCMTN
FT                   NSLEKLNREFSYPSIKQSPDGTLHIAYTWWRQAIKYVRISPEWVKGQAS"
     MSVALIRDGV IRPSENDSHV LTAMLPSSCP QNHAANILPM PDGALMCVWF AGTQEGIADI        60
     SVWGSRLPAG RTQWSDAVKL SHDDTRSEQN PVLFLAPDNV LWLLWTAQIS GNQDTAIVRY       120
     RKSDDLGQTW GEIATLLDKP GTFIRQPITV LDNGNWLLPV FYCRTQPGEK WVGNDDISAV       180
     KISADGGHSW RDVEVPQSLG CVHMNITMLH DGTLVALFRS RWADNIYISH SVDNGESWSV       240
     PQATELPNNN SSIQVTTLAS GELALVYNAM SAAGAVERRA SLYDEIDDGD DSRKEPTAVG       300
     RSAFWGAPRA PMTVAISADG GKSWPWRRNL DEGDGNCMTN NSLEKLNREF SYPSIKQSPD       360
     GTLHIAYTWW RQAIKYVRIS PEWVKGQAS                                         389
//

If you have problems or comments...

PBIL Back to PBIL home page