(data stored in ACNUC7421 zone)

EMBL: FM180568.PE566

FM180568.PE566       Location/Qualifiers
FT   CDS             complement(631240..632127)
FT                   /transl_table=11
FT                   /locus_tag="E2348C_0566"
FT                   /product="dihydrodipicolinate synthase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0566"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08114"
FT                   /db_xref="GOA:B7UKV6"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020625"
FT                   /db_xref="UniProtKB/TrEMBL:B7UKV6"
FT                   /protein_id="CAS08114.1"
FT                   /translation="MPKTIEGVLTAIVTPFTATGSLNIPALKVQVNRQLEAGNAIFCGG
FT                   TNGEFFVLNEQEKLSVTQTCVDEVAGRAPVVAHIGEISTRETIRLGQQIEKLGVDAVSV
FT                   IAPYFVPLKQEELIAHYSAIADALSIPMFLYNIPARTGNTIQPETARALASHPNIIGIK
FT                   DSAGSDESLKGFLDAVRDIDGFNVLNGPDSLIHKGFVEGCSACISGLANIAPREINAIW
FT                   SRFHAGDIEGSYEAQESVTGLRTDLYKVAFSPAAVKKALQLMGHDVGDSRYAVNFTPEQ
FT                   ISEIQQIIRHYNIN"
     MPKTIEGVLT AIVTPFTATG SLNIPALKVQ VNRQLEAGNA IFCGGTNGEF FVLNEQEKLS        60
     VTQTCVDEVA GRAPVVAHIG EISTRETIRL GQQIEKLGVD AVSVIAPYFV PLKQEELIAH       120
     YSAIADALSI PMFLYNIPAR TGNTIQPETA RALASHPNII GIKDSAGSDE SLKGFLDAVR       180
     DIDGFNVLNG PDSLIHKGFV EGCSACISGL ANIAPREINA IWSRFHAGDI EGSYEAQESV       240
     TGLRTDLYKV AFSPAAVKKA LQLMGHDVGD SRYAVNFTPE QISEIQQIIR HYNIN            295
//

If you have problems or comments...

PBIL Back to PBIL home page