(data stored in ACNUC7421 zone)

EMBL: FM180568.PE568

FM180568.PE568       Location/Qualifiers
FT   CDS             633458..634693
FT                   /transl_table=11
FT                   /locus_tag="E2348C_0568"
FT                   /product="predicted inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0568"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08116"
FT                   /db_xref="InterPro:IPR010737"
FT                   /db_xref="InterPro:IPR031475"
FT                   /db_xref="InterPro:IPR037051"
FT                   /db_xref="InterPro:IPR042213"
FT                   /db_xref="UniProtKB/TrEMBL:B7UKV8"
FT                   /protein_id="CAS08116.1"
FT                   /translation="MEKGITKPSILVVADDFTGANDAGVSLAQVGHTVDVAFEMPYHGD
FT                   ASVWVINSDSRAMDPKLAAMKITSLMSHLPLANNPPLVIKKIDSTLRGNIGAEIEALMK
FT                   ACGITGAVIAPAFPQAGRTTVAGECWVNGVRITETEFASDPKTPVLSARIADIIRLQTA
FT                   IPCQPVTVSQLSHLSYEQPWIGVIDAQTDSDLDRIAAAVMQAKQPLLLVGSAGICDAVA
FT                   RRSAIMPPPTVLAIIGSMSEIAQRQIATLHSHPRITQIYVDVEHILAGNASDYDARIVQ
FT                   ALQKGDHCIVHTCNDSVARHQIDTLCQRWQMSRAALGEKICRFLGELTRQVLLRTMPDA
FT                   LYLSGGDVAMATASALGATGFRITGKVAQCVPYGHFLGGVWSRSVMTKAGGFGDETTLH
FT                   QVLNFIEEKRSE"
     MEKGITKPSI LVVADDFTGA NDAGVSLAQV GHTVDVAFEM PYHGDASVWV INSDSRAMDP        60
     KLAAMKITSL MSHLPLANNP PLVIKKIDST LRGNIGAEIE ALMKACGITG AVIAPAFPQA       120
     GRTTVAGECW VNGVRITETE FASDPKTPVL SARIADIIRL QTAIPCQPVT VSQLSHLSYE       180
     QPWIGVIDAQ TDSDLDRIAA AVMQAKQPLL LVGSAGICDA VARRSAIMPP PTVLAIIGSM       240
     SEIAQRQIAT LHSHPRITQI YVDVEHILAG NASDYDARIV QALQKGDHCI VHTCNDSVAR       300
     HQIDTLCQRW QMSRAALGEK ICRFLGELTR QVLLRTMPDA LYLSGGDVAM ATASALGATG       360
     FRITGKVAQC VPYGHFLGGV WSRSVMTKAG GFGDETTLHQ VLNFIEEKRS E                411
//

If you have problems or comments...

PBIL Back to PBIL home page