(data stored in ACNUC7421 zone)

EMBL: FM180568.PE615

FM180568.PE615       Location/Qualifiers
FT   CDS             complement(683641..684585)
FT                   /transl_table=11
FT                   /locus_tag="E2348C_0615"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0615"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08163"
FT                   /db_xref="UniProtKB/TrEMBL:B7ULL1"
FT                   /protein_id="CAS08163.1"
FT                   /translation="MSPDNIGSAVNRFSGWPSNDPLKTDNESMTSPVTVQVIKMIAAIL
FT                   DPYRIVVGIDTLYTTQRETFTSESQQLIESALQTLHVINLNNLETNLDEDGHYLAFGYN
FT                   VDTPDRITVSAYNEKKPDCYGQCLLIQDDETDLFNLIKVKIFEARHNYVAQLMSDPEFM
FT                   FKFSYSAQQNRLEPHLLVPTYFPLKTNEPVTQEDVLLLYRFFKMDGDFNILTSDEYMSI
FT                   MTPLMKCERSIHDHNRYVTGKDTLLLDYPPSGNQIYFHIFPDESATLVLYFSNNDIECF
FT                   VFERDIPSQYRFFKMFTNLALVIDQLTDANQIL"
     MSPDNIGSAV NRFSGWPSND PLKTDNESMT SPVTVQVIKM IAAILDPYRI VVGIDTLYTT        60
     QRETFTSESQ QLIESALQTL HVINLNNLET NLDEDGHYLA FGYNVDTPDR ITVSAYNEKK       120
     PDCYGQCLLI QDDETDLFNL IKVKIFEARH NYVAQLMSDP EFMFKFSYSA QQNRLEPHLL       180
     VPTYFPLKTN EPVTQEDVLL LYRFFKMDGD FNILTSDEYM SIMTPLMKCE RSIHDHNRYV       240
     TGKDTLLLDY PPSGNQIYFH IFPDESATLV LYFSNNDIEC FVFERDIPSQ YRFFKMFTNL       300
     ALVIDQLTDA NQIL                                                         314
//

If you have problems or comments...

PBIL Back to PBIL home page