(data stored in ACNUC7421 zone)

EMBL: FM180568.PE652

FM180568.PE652       Location/Qualifiers
FT   CDS             complement(722197..722364)
FT                   /transl_table=11
FT                   /locus_tag="E2348C_0652"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0652"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08200"
FT                   /db_xref="UniProtKB/TrEMBL:B7ULP8"
FT                   /protein_id="CAS08200.1"
FT                   /translation="MHFRVTGEWNGEPFNRVIEAENINDCYNHWMIWAQIAHADVTNIR
FT                   IEELKEHQAA"
     MHFRVTGEWN GEPFNRVIEA ENINDCYNHW MIWAQIAHAD VTNIRIEELK EHQAA             55
//

If you have problems or comments...

PBIL Back to PBIL home page