(data stored in ACNUC7421 zone)

EMBL: FM180568.PE654

FM180568.PE654       Location/Qualifiers
FT   CDS             complement(722714..723346)
FT                   /transl_table=11
FT                   /locus_tag="E2348C_0654"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0654"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08202"
FT                   /db_xref="InterPro:IPR007539"
FT                   /db_xref="UniProtKB/TrEMBL:B7UG70"
FT                   /protein_id="CAS08202.1"
FT                   /translation="MTTITREQAQKIIEAADEVISALAGTNEDVHPGSDNMLRLWDDLN
FT                   DRYAPPEVVRELARIALASLEAEPVSQTYNLPELIEGMEVSIDVSTCDADLGNRYFGTV
FT                   TEALELDTAKNGYILLVQDAEPNFDVNGNSPVIPGGWISCSERMPDSKTAVLVAREFDR
FT                   KGDWRMKWATYIPGHPDANDGWVIPGASWIPSHWMPLPEPPQEVNHG"
     MTTITREQAQ KIIEAADEVI SALAGTNEDV HPGSDNMLRL WDDLNDRYAP PEVVRELARI        60
     ALASLEAEPV SQTYNLPELI EGMEVSIDVS TCDADLGNRY FGTVTEALEL DTAKNGYILL       120
     VQDAEPNFDV NGNSPVIPGG WISCSERMPD SKTAVLVARE FDRKGDWRMK WATYIPGHPD       180
     ANDGWVIPGA SWIPSHWMPL PEPPQEVNHG                                        210
//

If you have problems or comments...

PBIL Back to PBIL home page