(data stored in ACNUC7421 zone)

EMBL: FM180568.PE658

FM180568.PE658       Location/Qualifiers
FT   CDS             complement(724147..724785)
FT                   /transl_table=11
FT                   /locus_tag="E2348C_0658"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0658"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08206"
FT                   /db_xref="InterPro:IPR025153"
FT                   /db_xref="UniProtKB/TrEMBL:B7UG68"
FT                   /protein_id="CAS08206.1"
FT                   /translation="MSKIDHQALREAAEQAMHDDWGFDADLFHELVTPSIVLELLDEQE
FT                   RNQQYIKRRDQENEEIALTVGKLRVELEAAENNLIDSECHVAELEEALRDKQALLEASE
FT                   KRNAKLQSENAYIRNRYKELDLLIGKNILVMQAAIIEWQATGDAKSGLAWIYNTLFGPG
FT                   ELPDESEKDAQAYFNRKYAPIDEKLMALHKWFWEQSEAERAAGIRIKGE"
     MSKIDHQALR EAAEQAMHDD WGFDADLFHE LVTPSIVLEL LDEQERNQQY IKRRDQENEE        60
     IALTVGKLRV ELEAAENNLI DSECHVAELE EALRDKQALL EASEKRNAKL QSENAYIRNR       120
     YKELDLLIGK NILVMQAAII EWQATGDAKS GLAWIYNTLF GPGELPDESE KDAQAYFNRK       180
     YAPIDEKLMA LHKWFWEQSE AERAAGIRIK GE                                     212
//

If you have problems or comments...

PBIL Back to PBIL home page