(data stored in ACNUC7421 zone)

EMBL: FM180568.PE663

FM180568.PE663       Location/Qualifiers
FT   CDS             complement(726029..726496)
FT                   /transl_table=11
FT                   /locus_tag="E2348C_0663"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0663"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08211"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:B7UG64"
FT                   /protein_id="CAS08211.1"
FT                   /translation="MSHLDGIIKRFESSYKVNETTGCWESTYSKNKGGYTKFVAFGVTM
FT                   LSHRVAFELYHSPIPSGKMVCHKCDNQCCVNPEHLFLGSAQENMDDKIAKGRHRGAKKG
FT                   HAHHGAKLTEWQVIEIRKRLSEKESQYKIAKDMGVSQSIISNIKTGKRWSK"
     MSHLDGIIKR FESSYKVNET TGCWESTYSK NKGGYTKFVA FGVTMLSHRV AFELYHSPIP        60
     SGKMVCHKCD NQCCVNPEHL FLGSAQENMD DKIAKGRHRG AKKGHAHHGA KLTEWQVIEI       120
     RKRLSEKESQ YKIAKDMGVS QSIISNIKTG KRWSK                                  155
//

If you have problems or comments...

PBIL Back to PBIL home page