(data stored in ACNUC7421 zone)

EMBL: FM180568.PE664

FM180568.PE664       Location/Qualifiers
FT   CDS             complement(726497..727204)
FT                   /transl_table=11
FT                   /locus_tag="E2348C_0664"
FT                   /product="predicted recombination protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0664"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08212"
FT                   /db_xref="InterPro:IPR041247"
FT                   /db_xref="UniProtKB/TrEMBL:B7UG63"
FT                   /protein_id="CAS08212.1"
FT                   /translation="MDLNKFDEPFSPEDIEWRIQQSGKTRDGKVWAMVLAYVTNRAIMK
FT                   RLDDVCGKAGWRNEYRDIPNNGGVECGISIRIDSEWVTKWDAAENTQVEAVKGGRSGAM
FT                   KRAAVQWGIGRYLYNLEEGFAQTSLDKKQGWHRAKLKDGTGFYWLPPSLPGWAIPASDN
FT                   KPSPENTNQTSPSVDCEQILKDFSDYASTETDKKKLIERYQRDWQLMAGNEEAQAKCVQ
FT                   VMNIRVNELKQAA"
     MDLNKFDEPF SPEDIEWRIQ QSGKTRDGKV WAMVLAYVTN RAIMKRLDDV CGKAGWRNEY        60
     RDIPNNGGVE CGISIRIDSE WVTKWDAAEN TQVEAVKGGR SGAMKRAAVQ WGIGRYLYNL       120
     EEGFAQTSLD KKQGWHRAKL KDGTGFYWLP PSLPGWAIPA SDNKPSPENT NQTSPSVDCE       180
     QILKDFSDYA STETDKKKLI ERYQRDWQLM AGNEEAQAKC VQVMNIRVNE LKQAA            235
//

If you have problems or comments...

PBIL Back to PBIL home page