(data stored in ACNUC7421 zone)

EMBL: FM180568.PE665

FM180568.PE665       Location/Qualifiers
FT   CDS             complement(727213..727383)
FT                   /transl_table=11
FT                   /locus_tag="E2348C_0665"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0665"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08213"
FT                   /db_xref="UniProtKB/TrEMBL:B7ULR1"
FT                   /protein_id="CAS08213.1"
FT                   /translation="MSLATTVKESKLQRRMYTQKALWYRHNGDREGMRVCLNLSRVEVL
FT                   NQRYFLGPCPF"
     MSLATTVKES KLQRRMYTQK ALWYRHNGDR EGMRVCLNLS RVEVLNQRYF LGPCPF            56
//

If you have problems or comments...

PBIL Back to PBIL home page