(data stored in ACNUC7421 zone)

EMBL: FM180568.PE667

FM180568.PE667       Location/Qualifiers
FT   CDS             complement(727705..728073)
FT                   /transl_table=11
FT                   /locus_tag="E2348C_0667"
FT                   /product="predicted single-stranded DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0667"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08215"
FT                   /db_xref="GOA:B7ULR3"
FT                   /db_xref="InterPro:IPR024252"
FT                   /db_xref="UniProtKB/TrEMBL:B7ULR3"
FT                   /protein_id="CAS08215.1"
FT                   /translation="MSNIKKYIIDYDWKASIEIEIDHDLMTEEKLHQINNFWSDSEYRL
FT                   NKHGSVLNAVLIMLAQHALLIAISSDLNAYGVVCEFDWNDGNGQEGWPPMDGSEGIRIT
FT                   DIDTSGIFDSDDMTIKAA"
     MSNIKKYIID YDWKASIEIE IDHDLMTEEK LHQINNFWSD SEYRLNKHGS VLNAVLIMLA        60
     QHALLIAISS DLNAYGVVCE FDWNDGNGQE GWPPMDGSEG IRITDIDTSG IFDSDDMTIK       120
     AA                                                                      122
//

If you have problems or comments...

PBIL Back to PBIL home page