(data stored in ACNUC7421 zone)

EMBL: FM180568.PE668

FM180568.PE668       Location/Qualifiers
FT   CDS             complement(728253..728576)
FT                   /transl_table=11
FT                   /locus_tag="E2348C_0668"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0668"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08216"
FT                   /db_xref="UniProtKB/TrEMBL:B7ULR4"
FT                   /protein_id="CAS08216.1"
FT                   /translation="MEALVVERSEDGYWTHPEYANLFGDREVISADEFRSFCKQHGIES
FT                   SIVEMENDNNQTVIDAYFEDGNPNISGWEPSMPDGEGWFVGSIHDTEDGPICVWFRNVD
FT                   KAA"
     MEALVVERSE DGYWTHPEYA NLFGDREVIS ADEFRSFCKQ HGIESSIVEM ENDNNQTVID        60
     AYFEDGNPNI SGWEPSMPDG EGWFVGSIHD TEDGPICVWF RNVDKAA                     107
//

If you have problems or comments...

PBIL Back to PBIL home page