(data stored in ACNUC7421 zone)

EMBL: FM180568.PE671

FM180568.PE671       Location/Qualifiers
FT   CDS             complement(729618..730442)
FT                   /transl_table=11
FT                   /locus_tag="E2348C_0671"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0671"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08219"
FT                   /db_xref="GOA:B7ULR7"
FT                   /db_xref="UniProtKB/TrEMBL:B7ULR7"
FT                   /protein_id="CAS08219.1"
FT                   /translation="MITSLQGWEAIAKQSEGVLQELTGANILDISVHVARLEAGSLYED
FT                   IVIKLLFGSQEEMDKFLAGAHAKIGNGKMRNALVGAVVIGLVGYGLVLATKAMAPSNTS
FT                   HFEANNNTIINIGAGEANISPDRLQAIIESTVTNKKTLAKSSIKTLAPARADEGSTMVI
FT                   GTGGGTVTIPAETIKKAPTEVVFTPESYTQDHFDVDVEIRALDLDNPEKGWAAVIPGLI
FT                   DRRVNMVLGPNVNPSDFAGKFAVRADITITYQLKSSDKKYQPKEVFIKEIIK"
     MITSLQGWEA IAKQSEGVLQ ELTGANILDI SVHVARLEAG SLYEDIVIKL LFGSQEEMDK        60
     FLAGAHAKIG NGKMRNALVG AVVIGLVGYG LVLATKAMAP SNTSHFEANN NTIINIGAGE       120
     ANISPDRLQA IIESTVTNKK TLAKSSIKTL APARADEGST MVIGTGGGTV TIPAETIKKA       180
     PTEVVFTPES YTQDHFDVDV EIRALDLDNP EKGWAAVIPG LIDRRVNMVL GPNVNPSDFA       240
     GKFAVRADIT ITYQLKSSDK KYQPKEVFIK EIIK                                   274
//

If you have problems or comments...

PBIL Back to PBIL home page