(data stored in ACNUC7421 zone)

EMBL: FM180568.PE672

FM180568.PE672       Location/Qualifiers
FT   CDS             complement(730647..731354)
FT                   /transl_table=11
FT                   /locus_tag="E2348C_0672"
FT                   /product="predicted repressor protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0672"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08220"
FT                   /db_xref="GOA:B7ULR8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/TrEMBL:B7ULR8"
FT                   /protein_id="CAS08220.1"
FT                   /translation="MVQNEKVRKEFAQRLAQACKEAGLDEHGRGMAIARALSLSSKGVS
FT                   KWFNAESLPRQEKMNALAKFLNVDVVWLQHGTSLNGANDEDTFSIVGKLKKGLVRVVGE
FT                   AILGVDGAIEMTEERDGWLKIYSDDPDAFGLRVKGDSMWPRIKSGEYVLIEPNTKVFPG
FT                   DEVFVRTIEGHNMIKVLGYDRDGEYQFTSINQDHRPITLPYHQVAKVEYVAGILKQSRH
FT                   LDDIEAREWLKSS"
     MVQNEKVRKE FAQRLAQACK EAGLDEHGRG MAIARALSLS SKGVSKWFNA ESLPRQEKMN        60
     ALAKFLNVDV VWLQHGTSLN GANDEDTFSI VGKLKKGLVR VVGEAILGVD GAIEMTEERD       120
     GWLKIYSDDP DAFGLRVKGD SMWPRIKSGE YVLIEPNTKV FPGDEVFVRT IEGHNMIKVL       180
     GYDRDGEYQF TSINQDHRPI TLPYHQVAKV EYVAGILKQS RHLDDIEARE WLKSS            235
//

If you have problems or comments...

PBIL Back to PBIL home page