(data stored in ACNUC7421 zone)

EMBL: FM180568.PE674

FM180568.PE674       Location/Qualifiers
FT   CDS             731767..732066
FT                   /transl_table=11
FT                   /locus_tag="E2348C_0674"
FT                   /product="predicted regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0674"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08222"
FT                   /db_xref="GOA:B7ULS0"
FT                   /db_xref="InterPro:IPR007933"
FT                   /db_xref="UniProtKB/TrEMBL:B7ULS0"
FT                   /protein_id="CAS08222.1"
FT                   /translation="MEQTNYSKLSQRDVDRAETDLLINLSAITQRGLAKMIGCHESKIS
FT                   RTDWRFIASVLCAFGMASDISPISRAFKYALDGLTNKKRPVCKTERSDQIQMEF"
     MEQTNYSKLS QRDVDRAETD LLINLSAITQ RGLAKMIGCH ESKISRTDWR FIASVLCAFG        60
     MASDISPISR AFKYALDGLT NKKRPVCKTE RSDQIQMEF                               99
//

If you have problems or comments...

PBIL Back to PBIL home page