(data stored in ACNUC7421 zone)

EMBL: FM180568.PE675

FM180568.PE675       Location/Qualifiers
FT   CDS             732229..733005
FT                   /transl_table=11
FT                   /locus_tag="E2348C_0675"
FT                   /product="predicted replication protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0675"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08223"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B7ULS1"
FT                   /protein_id="CAS08223.1"
FT                   /translation="MSMNLMAKAMNIKVGNPLRKLVLIKLADNANDNGECWPSYQHVAD
FT                   QCEVSRSTVKSHIRALEEMGLLKREFRRKGELNQSNVFYLTLDNAQQIQPESGGAGAAR
FT                   GGAGADLGGGAGAAPRTYHSFEPVNEPKNIMFEHVRTECEKTPDRHEETDKAFEEIFWC
FT                   AGMRKAGKKNAASAFRTQFREWRKTTRGTASEFATMLAEDIACRNGKQFGFDRLLPSSY
FT                   LNGQRWNDEKPETIQPQSKPSSAITVSKTGYVFFDR"
     MSMNLMAKAM NIKVGNPLRK LVLIKLADNA NDNGECWPSY QHVADQCEVS RSTVKSHIRA        60
     LEEMGLLKRE FRRKGELNQS NVFYLTLDNA QQIQPESGGA GAARGGAGAD LGGGAGAAPR       120
     TYHSFEPVNE PKNIMFEHVR TECEKTPDRH EETDKAFEEI FWCAGMRKAG KKNAASAFRT       180
     QFREWRKTTR GTASEFATML AEDIACRNGK QFGFDRLLPS SYLNGQRWND EKPETIQPQS       240
     KPSSAITVSK TGYVFFDR                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page