(data stored in ACNUC7421 zone)

EMBL: FM180568.PE676

FM180568.PE676       Location/Qualifiers
FT   CDS             733113..734993
FT                   /transl_table=11
FT                   /locus_tag="E2348C_0676"
FT                   /product="predicted replication protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0676"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08224"
FT                   /db_xref="GOA:B7ULS2"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034154"
FT                   /db_xref="UniProtKB/TrEMBL:B7ULS2"
FT                   /protein_id="CAS08224.1"
FT                   /translation="MTPSELSDLLWAQVDRVAPHLLPNGKKEGHEWVAGNVNGDKGNSL
FT                   KVNLSGKKKWADFAEGDGGDMLDLWMACRGINLHQAMQEAKAFLGIKDDDHHFDAKREK
FT                   KFSRPDRKKIARYVTRTESHLEYLQSRGISPEVVKRYEVVSGKVWNGERELDALVLPYK
FT                   RDGELLQVKRISTERPDGKKVIMAEGDCEPCLFGWQALDAGVRAVVLCEGEIDCMSYAQ
FT                   YGISALSVPFGGGKGAKQQWIEFEYHNLDRFEEIFISMDVDDVGREAAREIASRLGEHR
FT                   CRLVTLPYKDINECLMNGVTEDEIWQYIGTASYFDPEELYSAREFYQDTINAFYGKQQY
FT                   LFNPPWESLADKFQFREAELTLVNGVNGHGKTEVVGHMALEAMRQGVKTCIASLELKPG
FT                   ILLKRLTRQATCCKMPPVLEIDSAFKFYDERLWVFGLTGTAKADRLIEIFDYARRRYGI
FT                   QLFIIDSLMKCGIGDDDYNGQKAFVDSICDFKNKTNSHVILVTHSRKGDSEEKPTGKMD
FT                   VKGSGAITDLTDNLFIIWRNKARERALQRVQSGEKMSEKDEQLLASPASVLMLEKQRNG
FT                   EGWEGGVPLFLDEQSHQFLQLESGSPYIYIANMPKSEYDESWRQENVTEY"
     MTPSELSDLL WAQVDRVAPH LLPNGKKEGH EWVAGNVNGD KGNSLKVNLS GKKKWADFAE        60
     GDGGDMLDLW MACRGINLHQ AMQEAKAFLG IKDDDHHFDA KREKKFSRPD RKKIARYVTR       120
     TESHLEYLQS RGISPEVVKR YEVVSGKVWN GERELDALVL PYKRDGELLQ VKRISTERPD       180
     GKKVIMAEGD CEPCLFGWQA LDAGVRAVVL CEGEIDCMSY AQYGISALSV PFGGGKGAKQ       240
     QWIEFEYHNL DRFEEIFISM DVDDVGREAA REIASRLGEH RCRLVTLPYK DINECLMNGV       300
     TEDEIWQYIG TASYFDPEEL YSAREFYQDT INAFYGKQQY LFNPPWESLA DKFQFREAEL       360
     TLVNGVNGHG KTEVVGHMAL EAMRQGVKTC IASLELKPGI LLKRLTRQAT CCKMPPVLEI       420
     DSAFKFYDER LWVFGLTGTA KADRLIEIFD YARRRYGIQL FIIDSLMKCG IGDDDYNGQK       480
     AFVDSICDFK NKTNSHVILV THSRKGDSEE KPTGKMDVKG SGAITDLTDN LFIIWRNKAR       540
     ERALQRVQSG EKMSEKDEQL LASPASVLML EKQRNGEGWE GGVPLFLDEQ SHQFLQLESG       600
     SPYIYIANMP KSEYDESWRQ ENVTEY                                            626
//

If you have problems or comments...

PBIL Back to PBIL home page