(data stored in ACNUC7421 zone)

EMBL: FM180568.PE68

FM180568.PE68        Location/Qualifiers
FT   CDS             75570..76523
FT                   /transl_table=11
FT                   /locus_tag="E2348C_0068"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0068"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07616"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:B7UIB3"
FT                   /protein_id="CAS07616.1"
FT                   /translation="MKRTLMSCAVASLLVSGSALAAWPEKPIQIIVPWGAGGNTDTVAR
FT                   LVAEGLQKELKVNVNVVNRTGGAGVVGHDAIAKAKADGYTLGIATVEITMMHHQGMTAL
FT                   TYQNYTPITRLAVNLGGVQVAANSQFENIVQMTDYIKANPGKLKASGSGLNSGWHLNLI
FT                   GMLDSMGLPPSAVTWVPSEGSSSALMELVSGGIDFTTSSPGEAKSMVDAKMVRNLATMA
FT                   EKSAGLYKDLPVFQQATGYKYHLATWNALVVPAGTPEEVSQKLTAAMQAVFAQGKLQEF
FT                   ATKQGFEVYPLYGKEMTTFMADEDARYGKLITKIKG"
     MKRTLMSCAV ASLLVSGSAL AAWPEKPIQI IVPWGAGGNT DTVARLVAEG LQKELKVNVN        60
     VVNRTGGAGV VGHDAIAKAK ADGYTLGIAT VEITMMHHQG MTALTYQNYT PITRLAVNLG       120
     GVQVAANSQF ENIVQMTDYI KANPGKLKAS GSGLNSGWHL NLIGMLDSMG LPPSAVTWVP       180
     SEGSSSALME LVSGGIDFTT SSPGEAKSMV DAKMVRNLAT MAEKSAGLYK DLPVFQQATG       240
     YKYHLATWNA LVVPAGTPEE VSQKLTAAMQ AVFAQGKLQE FATKQGFEVY PLYGKEMTTF       300
     MADEDARYGK LITKIKG                                                      317
//

If you have problems or comments...

PBIL Back to PBIL home page