(data stored in ACNUC7421 zone)

EMBL: FM180568.PE681

FM180568.PE681       Location/Qualifiers
FT   CDS             736389..736781
FT                   /transl_table=11
FT                   /locus_tag="E2348C_0681"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0681"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08229"
FT                   /db_xref="GOA:B7ULS7"
FT                   /db_xref="UniProtKB/TrEMBL:B7ULS7"
FT                   /protein_id="CAS08229.1"
FT                   /translation="MVISRYGKITFKHFQDNPTWAAAAGYDFNYFDCLSVACIATTNVA
FT                   NNIIDEFLDFPDYQVRELPAFFVKVSVATALLFILLFAYPLLAVFVYVRCKHSQNEYSG
FT                   EHTDITSQNMRVWLRRCQEKWGRSHG"
     MVISRYGKIT FKHFQDNPTW AAAAGYDFNY FDCLSVACIA TTNVANNIID EFLDFPDYQV        60
     RELPAFFVKV SVATALLFIL LFAYPLLAVF VYVRCKHSQN EYSGEHTDIT SQNMRVWLRR       120
     CQEKWGRSHG                                                              130
//

If you have problems or comments...

PBIL Back to PBIL home page