(data stored in ACNUC7421 zone)

EMBL: FM180568.PE682

FM180568.PE682       Location/Qualifiers
FT   CDS             736774..737064
FT                   /transl_table=11
FT                   /locus_tag="E2348C_0682"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0682"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08230"
FT                   /db_xref="InterPro:IPR010774"
FT                   /db_xref="UniProtKB/TrEMBL:B7ULS8"
FT                   /protein_id="CAS08230.1"
FT                   /translation="MANLRKEARGRECQVRIYGVCNGNPETTVLAHYRMAGICGTGMKP
FT                   DDLIGAWACSDCHAEIDRRTRILDNKDARLYHLEGVIRTQAILLKEGKIKS"
     MANLRKEARG RECQVRIYGV CNGNPETTVL AHYRMAGICG TGMKPDDLIG AWACSDCHAE        60
     IDRRTRILDN KDARLYHLEG VIRTQAILLK EGKIKS                                  96
//

If you have problems or comments...

PBIL Back to PBIL home page