(data stored in ACNUC7421 zone)

EMBL: FM180568.PE683

FM180568.PE683       Location/Qualifiers
FT   CDS             complement(737195..737554)
FT                   /transl_table=11
FT                   /locus_tag="E2348C_0683"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0683"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08231"
FT                   /db_xref="UniProtKB/TrEMBL:B7ULS9"
FT                   /protein_id="CAS08231.1"
FT                   /translation="MTLAFAVSVVLEHCSSCAGKHPRHFGLIASCLDKKLWYRLNCGVH
FT                   AFSSSVIFIPSRPPGTFTPRITRMSSNCSSSSANPAWIRESSKPFRMLSRSRRRESGTS
FT                   AMTLMRSRDLVKMSN"
     MTLAFAVSVV LEHCSSCAGK HPRHFGLIAS CLDKKLWYRL NCGVHAFSSS VIFIPSRPPG        60
     TFTPRITRMS SNCSSSSANP AWIRESSKPF RMLSRSRRRE SGTSAMTLMR SRDLVKMSN        119
//

If you have problems or comments...

PBIL Back to PBIL home page