(data stored in ACNUC7421 zone)

EMBL: FM180568.PE684

FM180568.PE684       Location/Qualifiers
FT   CDS             complement(737820..738779)
FT                   /transl_table=11
FT                   /locus_tag="E2348C_0684"
FT                   /product="SfpA (systemic factor protein A)-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0684"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08232"
FT                   /db_xref="InterPro:IPR018707"
FT                   /db_xref="InterPro:IPR037107"
FT                   /db_xref="UniProtKB/TrEMBL:B7ULT0"
FT                   /protein_id="CAS08232.1"
FT                   /translation="MKKSVIAGVFIALSFTTCSAIANSLALSLANDDAGKFQPILNDIY
FT                   GNKHENRDDYSQGLFLGYSHDISDSSQLSLHIAQDIYSPSGSNKRHNTAVTGDRAFSAY
FT                   THTGIEWNSLANDWIRYRLGTDIGVVGPDAGGQKVQNKAHEIIGAEKYHAWDDQIENRY
FT                   GYTVKGMLSMTPSMDILGANVGLYPEVSAVTGNLFQYVAYGATIAIGNDKTFNSDNGFG
FT                   LLAPRGLMHMSDTSGFKYKIFAGMERRDVNRNYTLEGKTIQTKQTTVSLNKTVDEYQVG
FT                   ATIGYAPVAFTLAFNKVTSEFKTGDDYSFINGAITFFF"
     MKKSVIAGVF IALSFTTCSA IANSLALSLA NDDAGKFQPI LNDIYGNKHE NRDDYSQGLF        60
     LGYSHDISDS SQLSLHIAQD IYSPSGSNKR HNTAVTGDRA FSAYTHTGIE WNSLANDWIR       120
     YRLGTDIGVV GPDAGGQKVQ NKAHEIIGAE KYHAWDDQIE NRYGYTVKGM LSMTPSMDIL       180
     GANVGLYPEV SAVTGNLFQY VAYGATIAIG NDKTFNSDNG FGLLAPRGLM HMSDTSGFKY       240
     KIFAGMERRD VNRNYTLEGK TIQTKQTTVS LNKTVDEYQV GATIGYAPVA FTLAFNKVTS       300
     EFKTGDDYSF INGAITFFF                                                    319
//

If you have problems or comments...

PBIL Back to PBIL home page