(data stored in ACNUC7421 zone)

EMBL: FM180568.PE686

FM180568.PE686       Location/Qualifiers
FT   CDS             740156..740872
FT                   /transl_table=11
FT                   /locus_tag="E2348C_0686"
FT                   /product="predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0686"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08234"
FT                   /db_xref="GOA:B7ULT2"
FT                   /db_xref="UniProtKB/TrEMBL:B7ULT2"
FT                   /protein_id="CAS08234.1"
FT                   /translation="MKDGALLRSSSLFIAYMGCLGWGSAYFYGWGTSFYYGFPWWIVGA
FT                   GVDDVARSLFFAVIVIAIFLIGWGIGVVFFFAVKRKHSMQELNVFRLYFAVELLFVPAI
FT                   IEFSILRQKIQVPLLLLSAAIALAVTISIRSYGRFLSVSCFYDKPFIKKHFFEIVMIAF
FT                   VAYFWLFSFLTGYYKPQFKKEYEMINYNDGWYYVLARYDNCLVLSTSFNAGSKRFVIYQ
FT                   SAQDKNLQVDIVRTRI"
     MKDGALLRSS SLFIAYMGCL GWGSAYFYGW GTSFYYGFPW WIVGAGVDDV ARSLFFAVIV        60
     IAIFLIGWGI GVVFFFAVKR KHSMQELNVF RLYFAVELLF VPAIIEFSIL RQKIQVPLLL       120
     LSAAIALAVT ISIRSYGRFL SVSCFYDKPF IKKHFFEIVM IAFVAYFWLF SFLTGYYKPQ       180
     FKKEYEMINY NDGWYYVLAR YDNCLVLSTS FNAGSKRFVI YQSAQDKNLQ VDIVRTRI         238
//

If you have problems or comments...

PBIL Back to PBIL home page