(data stored in ACNUC7421 zone)

EMBL: FM180568.PE689

FM180568.PE689       Location/Qualifiers
FT   CDS             743713..743919
FT                   /transl_table=11
FT                   /locus_tag="E2348C_0689"
FT                   /product="predicted holin protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0689"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08237"
FT                   /db_xref="GOA:B7ULT5"
FT                   /db_xref="InterPro:IPR007054"
FT                   /db_xref="UniProtKB/TrEMBL:B7ULT5"
FT                   /protein_id="CAS08237.1"
FT                   /translation="MEKITTGVSYTTSAVGTGYWLLQLLDKVSPSQWVAIGVLGSLLFG
FT                   LLTYLTNLYFKIKEDKRKAARGE"
     MEKITTGVSY TTSAVGTGYW LLQLLDKVSP SQWVAIGVLG SLLFGLLTYL TNLYFKIKED        60
     KRKAARGE                                                                 68
//

If you have problems or comments...

PBIL Back to PBIL home page