(data stored in ACNUC7421 zone)

EMBL: FM180568.PE69

FM180568.PE69        Location/Qualifiers
FT   CDS             76572..77009
FT                   /transl_table=11
FT                   /locus_tag="E2348C_0069"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0069"
FT                   /db_xref="EnsemblGenomes-Tr:CAS07617"
FT                   /db_xref="GOA:B7UIB4"
FT                   /db_xref="InterPro:IPR009936"
FT                   /db_xref="UniProtKB/TrEMBL:B7UIB4"
FT                   /protein_id="CAS07617.1"
FT                   /translation="MRIIPVTPLFLLIFAMFIFGWSITQYGGISQYGAGFMPCIISGLL
FT                   LFLAAIDVAIDIKHRHRNKVSLTLDEVKALLLVITVVLLFVLLLDILGFVICSFLLLFI
FT                   LMKIRGVRLLHSVIVSISASLIIWFIFARVLLVAFPEGILF"
     MRIIPVTPLF LLIFAMFIFG WSITQYGGIS QYGAGFMPCI ISGLLLFLAA IDVAIDIKHR        60
     HRNKVSLTLD EVKALLLVIT VVLLFVLLLD ILGFVICSFL LLFILMKIRG VRLLHSVIVS       120
     ISASLIIWFI FARVLLVAFP EGILF                                             145
//

If you have problems or comments...

PBIL Back to PBIL home page