(data stored in ACNUC7421 zone)

EMBL: FM180568.PE694

FM180568.PE694       Location/Qualifiers
FT   CDS             complement(745805..745999)
FT                   /transl_table=11
FT                   /locus_tag="E2348C_0694"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0694"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08242"
FT                   /db_xref="InterPro:IPR025030"
FT                   /db_xref="UniProtKB/TrEMBL:B7ULU0"
FT                   /protein_id="CAS08242.1"
FT                   /translation="MSTKNRTRRTTTRNIRFPNQMIEQINIALEQKGSGNFSAWVIEAC
FT                   RRRLTSEKRAYTSIQSDDG"
     MSTKNRTRRT TTRNIRFPNQ MIEQINIALE QKGSGNFSAW VIEACRRRLT SEKRAYTSIQ        60
     SDDG                                                                     64
//

If you have problems or comments...

PBIL Back to PBIL home page