(data stored in ACNUC7421 zone)

EMBL: FM180568.PE695

FM180568.PE695       Location/Qualifiers
FT   CDS             746394..746903
FT                   /transl_table=11
FT                   /locus_tag="E2348C_0695"
FT                   /product="predicted terminase small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:E2348C_0695"
FT                   /db_xref="EnsemblGenomes-Tr:CAS08243"
FT                   /db_xref="InterPro:IPR010906"
FT                   /db_xref="UniProtKB/TrEMBL:B7ULU1"
FT                   /protein_id="CAS08243.1"
FT                   /translation="MATQTEVARHLSLTDRQLRRLQKLPGAPISNKRGQLDLDAWRDFY
FT                   ISYLRRSKNDVPDGDSEDDYEEKLLIARWELTAEQAVTQQLKNEVSKGKLIDTGFCIFA
FT                   LSKLAMALSSTLDSIPLSMQRQFPDLTPRHLDHLKTLIAKGANQCARAGDKLPDLLDEY
FT                   IRATTE"
     MATQTEVARH LSLTDRQLRR LQKLPGAPIS NKRGQLDLDA WRDFYISYLR RSKNDVPDGD        60
     SEDDYEEKLL IARWELTAEQ AVTQQLKNEV SKGKLIDTGF CIFALSKLAM ALSSTLDSIP       120
     LSMQRQFPDL TPRHLDHLKT LIAKGANQCA RAGDKLPDLL DEYIRATTE                   169
//

If you have problems or comments...

PBIL Back to PBIL home page